PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof020123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 121aa    MW: 13860.7 Da    PI: 9.7576
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-22995PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53.1e-203286256
               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
               +++ +f++eq++ Le++F+ + ++  +++ +LA++lgL+ rqV +WFqN+Ra++k
  Sof020123 32 KNKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWK 86
               67789*************************************************9 PP

2HD-ZIP_I/II109.91.7e-3533116285
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeve 85 
                  +k+r+s+eq+k+LE++F +++kLep++K +lareLglqprqva+WFqn+RAR+k+kqlE++y + ++ yd    + e+ +ke++
    Sof020123  33 NKKRFSEEQIKSLESMFATQTKLEPRQKLQLARELGLQPRQVAIWFQNKRARWKSKQLEREYXRARDDYDXALCSYESXQKEKH 116
                  79***********************************************************************99999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.13E-202090IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-202089IPR009057Homeodomain-like
PROSITE profilePS5007117.3292888IPR001356Homeobox domain
SMARTSM003891.9E-163192IPR001356Homeobox domain
CDDcd000869.21E-143289No hitNo description
PfamPF000461.3E-173286IPR001356Homeobox domain
PRINTSPR000313.0E-65968IPR000047Helix-turn-helix motif
PROSITE patternPS0002706386IPR017970Homeobox, conserved site
PRINTSPR000313.0E-66884IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MDGEDDVPEW MMEVGGAGGK GGKGGGGGPL DKNKKRFSEE QIKSLESMFA TQTKLEPRQK  60
LQLARELGLQ PRQVAIWFQN KRARWKSKQL EREYXRARDD YDXALCSYES XQKEKHAPLK  120
X
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12027GGKGGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462710.18e-61hypothetical protein SORBIDRAFT_02g030660
SwissprotQ651Z51e-49HOX6_ORYSJ; Homeobox-leucine zipper protein HOX6
SwissprotQ9XH351e-49HOX6_ORYSI; Homeobox-leucine zipper protein HOX6
TrEMBLC5X6579e-61C5X657_SORBI; Putative uncharacterized protein Sb02g030660
STRINGSb02g030660.13e-60(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.24e-31homeobox 7